SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000304762 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000304762
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 3.22e-46
Family C-type lysozyme 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000304762   Gene: ENSG00000171478   Transcript: ENST00000304270
Sequence length 159
Comment pep:known chromosome:GRCh38:X:48130657:48132613:1 gene:ENSG00000171478 transcript:ENST00000304270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFD
TAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVS
SQNGLSAWTSWRLHCSGHDLSEWLKGCDMHVKIDPKIHP
Download sequence
Identical sequences A0A140VJN7 G3SBU4 H2QYJ5 Q96QH8
ENSP00000304762 ENSP00000305847 ENSP00000366139 ENSP00000471332 ENSP00000471854 ENSP00000472148 gi|118498373|ref|NP_995328.2| gi|120952755|ref|NP_001073369.1| ENSGGOP00000025571 ENSPTRP00000037522 ENSGGOP00000025571 ENSPTRP00000037522 NP_001073369.1.87134 NP_001073369.1.92137 NP_995328.2.87134 NP_995328.2.92137 XP_003812199.1.60992 XP_004064139.1.27298 XP_009437295.1.37143 XP_016885001.1.92137 ENSP00000304762 ENSP00000305847 9598.ENSPTRP00000037522 9606.ENSP00000304762 9606.ENSP00000305847 ENSP00000304762 ENSP00000305847 ENSP00000366139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]