SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000310929 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000310929
Domain Number 1 Region: 16-146
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-31
Family C-type lectin domain 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000310929   Gene: ENSG00000134539   Transcript: ENST00000350274
Sequence length 148
Comment pep:known chromosome:GRCh38:12:10307818:10317251:1 gene:ENSG00000134539 transcript:ENST00000350274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCAS
QKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKN
CIAYNPNGNALDESCEDKNRYICKQQLI
Download sequence
Identical sequences ENSP00000310929 gi|7669499|ref|NP_031360.1| ENSP00000310929 NP_031360.1.87134 NP_031360.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]