SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000312774 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000312774
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000342
Family Snake venom toxins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000312774   Gene: ENSG00000177202   Transcript: ENST00000321762
Sequence length 124
Comment pep:known chromosome:GRCh38:19:48606743:48607714:1 gene:ENSG00000177202 transcript:ENST00000321762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPV
INKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLP
PRLL
Download sequence
Identical sequences A0A140VJU1 A0A2I3TN96 Q8TDM5
ENSPTRP00000019288 gi|19424138|ref|NP_598005.1| ENSP00000312774 NP_598005.1.87134 NP_598005.1.92137 XP_001171475.1.37143 XP_003814134.1.60992 ENSP00000312774 ENSP00000312774 ENSPTRP00000019288 NYSGRC-19424138 9598.ENSPTRP00000019288 9606.ENSP00000312774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]