SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000314566 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000314566
Domain Number 1 Region: 80-253
Classification Level Classification E-value
Superfamily Sec7 domain 4.19e-71
Family Sec7 domain 0.0000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000314566   Gene: ENSG00000105443   Transcript: ENST00000325139
Sequence length 254
Comment pep:putative chromosome:GRCh38:19:48469634:48474330:1 gene:ENSG00000105443 transcript:ENST00000325139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVVRITRSPATSPVMESENQGLSPLPKPPDLTPEERMELENIRRRKQELLVEIQRLRE
ELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIAR
FLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQ
KIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNR
GINEGGDLPEELLR
Download sequence
Identical sequences A0A2J8K236 F8W8E2
ENSP00000314566 ENSP00000314566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]