SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000315074 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000315074
Domain Number 1 Region: 170-494
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.31e-77
Family Pancreatic carboxypeptidases 0.0000019
Further Details:      
 
Domain Number 2 Region: 31-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.71e-32
Family Frizzled cysteine-rich domain 0.0008
Further Details:      
 
Domain Number 3 Region: 494-573
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.34e-18
Family Carboxypeptidase regulatory domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000315074   Gene: ENSG00000109625   Transcript: ENST00000315782
Sequence length 641
Comment pep:novel chromosome:GRCh38:4:8592756:8619749:1 gene:ENSG00000109625 transcript:ENST00000315782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPLPLLLLTVLVVAAARPGCEFERNPAATCVDLQLRTCSDAAYNHTTFPNLLQHRSWE
VVEASSEYILLSVLHQLLEGQCNPDLRLLGCAVLAPRCEGGWVRRPCRHICEGLREVCQP
AFDAIDMAWPYFLDCHRYFTREDEGCYDPLEKLRGGLEADEALPSGLPPTFIRFSHHSYA
QMVRVLRRTASRCAHVARTYSIGRSFDGRELLVIEFSSRPGQHELMEPEVKLIGNIHGNE
VAGREMLIYLAQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTS
GRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIPQHYWWGKVAPETKAIMKWMQTI
PFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSEN
RCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPEEALYILWQHN
KESLLNFVETVHRGIKGVVTDKFGKPVKNARISVKGIRHDITTAPDGDYWRLLPPGIHIV
IAQAPGYAKVIKKVIIPARMKRAGRVDFILQPLGMGPKNFIHGLRRTGPHDPLGGASSLG
EATEPDPLRARRQPSADGSKPWWWSYFTSLSTHRPRWLLKY
Download sequence
Identical sequences ENSP00000315074 ENSP00000315074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]