SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000315303 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000315303
Domain Number 1 Region: 11-191
Classification Level Classification E-value
Superfamily Rhomboid-like 2.75e-19
Family Rhomboid-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000315303   Gene: ENSG00000099958   Transcript: ENST00000318109
Sequence length 235
Comment pep:known chromosome:GRCh38:22:23836734:23839004:-1 gene:ENSG00000099958 transcript:ENST00000318109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL
GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLPPPQQ
Download sequence
Identical sequences Q96Q80
gi|50845411|ref|NP_001002862.1| NP_001002862.1.87134 NP_001002862.1.92137 ENSP00000315303 ENSP00000315303 ENSP00000483693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]