SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000318650 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000318650
Domain Number - Region: 42-76
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00249
Family Toll/Interleukin receptor TIR domain 0.0096
Further Details:      
 
Domain Number - Region: 73-166
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0357
Family Gonadodropin/Follitropin 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000318650   Gene: ENSG00000180875   Transcript: ENST00000318160
Sequence length 168
Comment pep:known chromosome:GRCh38:1:240489573:240612149:-1 gene:ENSG00000180875 transcript:ENST00000318160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
VVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSC
AFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
Download sequence
Identical sequences A0A024R3Y1 A0A096MLY5 A0A2I2ZEZ2 A0A2K5C3I5 A0A2K5HJJ1 A0A2K5L2F0 A0A2K5PN94 A0A2K5US66 A0A2K5XLC3 A0A2K6AP00 A0A2K6JVD7 A0A2K6NH78 F7HBP1 F7IL92 H2N3A5 H2Q1E8 Q9H772
gi|71164892|ref|NP_071914.3| ENSP00000318650 ENSP00000318650 ENSPTRP00000003651 ENSP00000318650 ENSPPYP00000000072 ENSCJAP00000040599 ENSMMUP00000010838 9544.ENSMMUP00000010838 9598.ENSPTRP00000003651 9600.ENSPPYP00000000072 9606.ENSP00000318650 ENSMMUP00000010838 ENSPANP00000000589 ENSPTRP00000003651 NP_001253037.1.72884 NP_071914.3.87134 NP_071914.3.92137 XP_002760922.1.60252 XP_002809305.1.23681 XP_003824571.1.60992 XP_005539737.1.63531 XP_010382990.1.97406 XP_011542551.1.92137 XP_011727759.1.29376 XP_011811068.1.43180 XP_011850415.1.47321 XP_011891648.1.92194 XP_012299184.1.9421 XP_017735254.1.44346 XP_018887684.1.27298 XP_525111.2.37143 ENSCJAP00000040599 ENSPPYP00000000072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]