SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000319208 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000319208
Domain Number 1 Region: 70-315
Classification Level Classification E-value
Superfamily SET domain 8.63e-80
Family Histone lysine methyltransferases 0.0000204
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000176
Family Chromo domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000319208   Gene: ENSG00000152455   Transcript: ENST00000313519
Sequence length 350
Comment pep:putative chromosome:GRCh38:10:14878900:14904315:1 gene:ENSG00000152455 transcript:ENST00000313519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Download sequence
Identical sequences H2QZV9
gi|13375930|ref|NP_078946.1| gi|301171597|ref|NP_001180354.1| ENSPTRP00000039650 9606.ENSP00000319208 ENSPTRP00000039650 NP_001180354.1.87134 NP_001180354.1.92137 NP_078946.1.87134 NP_078946.1.92137 XP_001147571.1.37143 XP_006717566.1.92137 XP_008955492.1.60992 XP_008955498.1.60992 XP_008955509.1.60992 XP_008955519.1.60992 XP_009456274.1.37143 XP_009456275.1.37143 XP_009456276.1.37143 XP_011517964.1.92137 XP_016818180.1.37143 XP_016872126.1.92137 ENSP00000319208 ENSP00000319208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]