SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000319851 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000319851
Domain Number 1 Region: 39-326,511-574
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-89
Family FAD-linked reductases, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 333-515
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.08e-55
Family GMC oxidoreductases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000319851   Gene: ENSG00000016391   Transcript: ENST00000315251
Sequence length 594
Comment pep:known chromosome:GRCh38:3:53812335:53846390:-1 gene:ENSG00000016391 transcript:ENST00000315251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCLLRGLGRPGALARGALGQQQSLGARALASAGSESRDEYSYVVVGAGSAGCVLAGRLT
EDPAERVLLLEAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVL
YWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASRY
RGADGPLRVSRGKTNHPLHCAFLEATQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSA
ACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAIN
SPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLR
KVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY
QVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAP
FRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENL
RVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR
Download sequence
Identical sequences Q8NE62
ENSP00000319851 gi|217272839|ref|NP_060867.2| NP_060867.2.87134 NP_060867.2.92137 XP_016862286.1.92137 XP_016862287.1.92137 ENSP00000319851 ENSP00000319851 9606.ENSP00000319851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]