SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000321810 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000321810
Domain Number 1 Region: 24-135,223-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000988
Family Shikimate kinase (AroK) 0.064
Further Details:      
 
Domain Number 2 Region: 382-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000247
Family HkH motif-containing C2H2 finger 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000321810   Gene: ENSG00000043514   Transcript: ENST00000316891
Sequence length 467
Comment pep:known chromosome:GRCh38:1:39841051:39883506:-1 gene:ENSG00000043514 transcript:ENST00000316891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVG
GTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPH
DKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERL
DKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTL
ETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVL
EPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL
NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV
Download sequence
Identical sequences Q9H3H1
gi|31581534|ref|NP_060116.2| NP_060116.2.87134 NP_060116.2.92137 9606.ENSP00000321810 ENSP00000046894 HR5056 hso003002118.1 ENSP00000321810 ENSP00000321810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]