SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000325919 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000325919
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0000000432
Family Cgl1923-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000325919   Gene: ENSG00000128789   Transcript: ENST00000317615
Sequence length 264
Comment pep:known chromosome:GRCh38:18:12702426:12725740:1 gene:ENSG00000128789 transcript:ENST00000317615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNP
YATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIV
LSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIR
IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTV
SASRWKIPSSWRLLFGSGLPPALF
Download sequence
Identical sequences Q969U7
ENSP00000325919 gi|22726189|ref|NP_064617.2| 9606.ENSP00000325919 ENSP00000325919 NP_064617.2.87134 NP_064617.2.92137 ENSP00000325919 GO.36769 HR2416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]