SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000327431 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000327431
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily Globin-like 1.7e-55
Family Globins 0.000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000327431   Gene: ENSG00000213934   Transcript: ENST00000330597
Sequence length 147
Comment pep:known chromosome:GRCh38:11:5248083:5249892:-1 gene:ENSG00000213934 transcript:ENST00000330597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFG
KEFTPEVQASWQKMVTAVASALSSRYH
Download sequence
Identical sequences D9YZU8
ENSP00000327431 gi|28302131|ref|NP_000550.2| ENSP00000327431 ENSP00000327431 NP_000550.2.87134 NP_000550.2.92137 9606.ENSP00000327431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]