SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000327597 from Homo sapiens 76_38

(show help)
Strong hits

Sequence:	ENSP00000327597
Domain Number 1	Region: 240-297
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.66e-25
Family	Classic zinc finger, C2H2	0.004
Further Details:

Domain Number 2	Region: 17-79
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	4.97e-23
Family	KRAB domain (Kruppel-associated box)	0.0014
Further Details:

Domain Number 3	Region: 296-353
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.17e-22
Family	Classic zinc finger, C2H2	0.0068
Further Details:

Domain Number 4	Region: 352-409
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	5.46e-22
Family	Classic zinc finger, C2H2	0.0083
Further Details:

Domain Number 5	Region: 394-446
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.33e-20
Family	Classic zinc finger, C2H2	0.0047
Further Details:

Domain Number 6	Region: 204-254
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	7.95e-16
Family	Classic zinc finger, C2H2	0.004
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSP00000327597 Gene: ENSG00000167554 Transcript: ENST00000327920
Sequence length	462
Comment	pep:known chromosome:GRCh38:19:52345429:52366858:1 gene:ENSG00000167554 transcript:ENST00000327920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MLCDEEAQKRKAKESGMALPQGRLTFMDVAIEFSQEEWKSLDPGQRALYRDVMLENYRNL VFLGICLPDLSIISMLKQRREPLILQSQVKIVKNTDGRECVRSVNTGRSCVLGSNAENKP IKNQLGLTLEAHLSELQLFQAGRKIYRSNQVEKFTNHRSSVSPLQKISSSFTTHIFNKYR NDLIDFPLLPQEEKAYIRGKSYEYECSEDGEVFRVRASLTNHQVIHTAEKPYKCTECGKV FSRNSHLVEHWRIHTGQKPYKCSECDKVFNRNSNLARHQRIHTGEKPHKCNECGKAFREC SGLTTHLVIHTGEKPYKCNECGKNFRHKFSLTNHQRSHTAEKPYKCNECGKVFSLLSYLA RHQIIHSTEKPYKCNECGRAFHKRPGLMAHLLIHTGEKPYKCNECDKVFGRKLYLTNHQR IHTGERPYKCNACGKVFNQNPHLSRHRKIHAGENSLRTLQME
Download sequence
Identical sequences	Q8N9Z0 ENSP00000324441 ENSP00000327597 ENSP00000383922 ENSP00000485001 9606.ENSP00000327597 ENSP00000324441 ENSP00000324441 ENSP00000327597 ENSP00000383922 gi\|239787098\|ref\|NP_001154897.1\| gi\|239787101\|ref\|NP_001154898.1\| gi\|239787104\|ref\|NP_775801.2\| NP_001154897.1.87134 NP_001154897.1.92137 NP_001154898.1.87134 NP_001154898.1.92137 NP_775801.2.87134 NP_775801.2.92137

SEARCH