SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000328777 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000328777
Domain Number 1 Region: 29-163
Classification Level Classification E-value
Superfamily Cupredoxins 2.43e-52
Family Ephrin ectodomain 0.0000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000328777   Gene: ENSG00000184349   Transcript: ENST00000333274
Sequence length 228
Comment pep:known chromosome:GRCh38:5:107376889:107670895:-1 gene:ENSG00000184349 transcript:ENST00000333274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
Download sequence
Identical sequences A0A2K5QSZ4 A0A2K6GUL2 A0A2K6V1M4 G1RK43 G3QDP0 H0VEU0 H2PG80 H2QRA5 P52803
ENSPTRP00000029298 ENSP00000328777 9598.ENSPTRP00000029298 9600.ENSPPYP00000017522 9606.ENSP00000328777 ENSGGOP00000000364 ENSPTRP00000029298 ENSNLEP00000013600 ENSP00000328777 ENSP00000328777 ENSNLEP00000013600 ENSPPYP00000017522 gi|4503487|ref|NP_001953.1| ENSPPYP00000017522 NP_001953.1.87134 NP_001953.1.92137 XP_002815814.1.23681 XP_003259858.1.23891 XP_003463586.1.53824 XP_003788975.1.62490 XP_003826809.1.60992 XP_003920760.1.74449 XP_003981221.1.62641 XP_004393840.1.74151 XP_004420385.1.5094 XP_004778320.1.14098 XP_008504839.1.77740 XP_010606898.1.5607 XP_012502824.1.63892 XP_014708463.1.49734 XP_017382725.1.71028 XP_018884018.1.27298 XP_019306080.1.44245 XP_021557182.1.83697 XP_526972.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]