SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000331708 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000331708
Domain Number 1 Region: 85-153
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.88e-29
Family Skp1 dimerisation domain-like 0.0000142
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 1.2e-25
Family BTB/POZ domain 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000331708   Gene: ENSG00000113558   Transcript: ENST00000328392
Sequence length 158
Comment pep:novel chromosome:GRCh38:5:134157941:134176950:-1 gene:ENSG00000113558 transcript:ENST00000328392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQQGRIKT
Download sequence
Identical sequences F8W8N3
ENSP00000331708 ENSP00000331708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]