SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000332530 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000332530
Domain Number 1 Region: 4-164,269-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-19
Family FAD-linked reductases, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332530   Gene: ENSG00000184719   Transcript: ENST00000331772
Sequence length 342
Comment pep:known chromosome:GRCh38:10:88284959:88583213:-1 gene:ENSG00000184719 transcript:ENST00000331772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGA
QYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLK
ESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISEC
QRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGP
SLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC
PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
Download sequence
Identical sequences Q5VYX0
ENSP00000332530 ENSP00000361015 ENSP00000332530 gi|237649117|ref|NP_001026879.2| NP_001026879.2.87134 NP_001026879.2.92137 9606.ENSP00000332530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]