SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000333650 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000333650
Domain Number 1 Region: 45-133
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 6.28e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000333650   Gene: ENSG00000251201   Transcript: ENST00000333314
Sequence length 188
Comment pep:putative chromosome:GRCh38:5:115578651:115626014:-1 gene:ENSG00000251201 transcript:ENST00000333314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHK
TVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAE
DLNTRVAY
Download sequence
Identical sequences A0A0A6YYA0
ENSP00000333650 gi|256985102|ref|NP_001157941.1| ENSP00000333650 NP_001157941.1.87134 NP_001157941.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]