SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000333982 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000333982
Domain Number - Region: 98-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00471
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000333982   Gene: ENSG00000166579   Transcript: ENST00000334527
Sequence length 345
Comment pep:known chromosome:GRCh38:17:8435861:8468160:1 gene:ENSG00000166579 transcript:ENST00000334527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQ
RNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQ
ANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQE
LAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGTENTFPSPKAIPNGFG
TSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYISGNVNCGVLNGNG
TKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLSV
Download sequence
Identical sequences A0A2I3LFP9 A0A2K5CN23 A0A2K5H854 A0A2K5P485 A0A2K5WMX1 A0A2K5YXY4 A0A2K6T471 F6UAG5 G3S5K6 K7CHH7 Q9GZM8
ENSP00000333982 gi|13540600|ref|NP_110435.1| HR5278 ENSMMUP00000035233 9606.ENSP00000333982 ENSP00000333982 NP_110435.1.87134 NP_110435.1.92137 XP_003929274.1.74449 XP_004058609.1.27298 XP_011906740.1.92194 XP_012312996.1.9421 XP_014974057.1.72884 XP_014974058.1.72884 XP_014974059.1.72884 XP_016786060.1.37143 XP_016786061.1.37143 XP_016786063.1.37143 XP_016880674.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]