SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000335144 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000335144
Domain Number 1 Region: 40-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000641
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000335144   Gene: ENSG00000134779   Transcript: ENST00000334295
Sequence length 300
Comment pep:known chromosome:GRCh38:18:36794106:36829195:-1 gene:ENSG00000134779 transcript:ENST00000334295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLAD
LEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPITYNTNLLTEETD
SFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKGPSGPSGPSTSSTSKSSSGSGNPTRK
Download sequence
Identical sequences H2QEG2 Q68CL5
ENSPTRP00000016969 NP_056291.2.87134 NP_056291.2.92137 XP_001140586.1.37143 XP_003830264.1.60992 9598.ENSPTRP00000016969 9606.ENSP00000335144 ENSP00000335144 gi|68534957|ref|NP_056291.2| ENSP00000335144 ENSPTRP00000016969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]