SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000338093 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000338093
Domain Number 1 Region: 401-683
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.86e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000967
Further Details:      
 
Domain Number 2 Region: 224-398
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.35e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00015
Further Details:      
 
Domain Number 3 Region: 685-792
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.93e-26
Family Anticodon-binding domain of Class II aaRS 0.0014
Further Details:      
 
Domain Number 4 Region: 163-223
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000262
Family TGS domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000338093   Gene: ENSG00000185418   Transcript: ENST00000335968
Sequence length 802
Comment pep:known chromosome:GRCh38:15:101653598:101724604:-1 gene:ENSG00000185418 transcript:ENST00000335968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEALAAEAVASRLERQEEDIRWLWSEVERLRDEQLNAPYSCQAEGPCLTREVAQLRAE
NCDLRHRLCSLRLCLAEERSRQATLESAELEAAQEAGAQPPPSQSQDKDMKKKKMKESEA
DSEVKHQPIFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTT
PYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHIL
GEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEV
SKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNS
STYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPG
SCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEI
EKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQD
DAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQN
SLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKDGD
DKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEF
FEEGFMADVDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKIDNAVNVRTRDNKIHGEILV
TSAIDKLKNLRKTRTLNAEEAF
Download sequence
Identical sequences A2RTX5
gi|38570111|ref|NP_689547.2| ENSP00000338093 ENSP00000338093 NP_689547.2.87134 NP_689547.2.92137 ENSP00000338093 NYSGRC-38570111 9606.ENSP00000338093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]