SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000338568 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000338568
Domain Number 1 Region: 26-297
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 2.75e-84
Family ATP synthase (F1-ATPase), gamma subunit 0.000000000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000338568   Gene: ENSG00000165629   Transcript: ENST00000335698
Sequence length 297
Comment pep:known chromosome:GRCh38:10:7788177:7807815:1 gene:ENSG00000165629 transcript:ENST00000335698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVAT
LTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYY
SLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
Download sequence
Identical sequences A0A2I2ZNG8 K7AMT0
gi|4885079|ref|NP_005165.1| ENSP00000338568 NP_005165.1.87134 NP_005165.1.92137 XP_003827852.1.60992 XP_004049091.1.27298 XP_507649.2.37143 ENSP00000338568 Hs4885079___KOG1531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]