SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000339157 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000339157
Domain Number 1 Region: 14-313
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.31e-79
Family Pancreatic carboxypeptidases 0.000000000207
Further Details:      
 
Domain Number 2 Region: 314-411
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 9.81e-24
Family Carboxypeptidase regulatory domain 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000339157   Gene: ENSG00000135678   Transcript: ENST00000338356
Sequence length 443
Comment pep:known chromosome:GRCh38:12:68851180:68932884:-1 gene:ENSG00000135678 transcript:ENST00000338356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVL
VVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIH
IMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKT
ETFVLSANLHGGALVASYPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGD
ECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNN
KASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSY
IINVTVPGHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLP
DHSAATKPSLFLFLVSLLHIFFK
Download sequence
Identical sequences P14384
NP_001005502.1.87134 NP_001005502.1.92137 NP_001865.1.87134 NP_001865.1.92137 NP_938079.1.87134 NP_938079.1.92137 9606.ENSP00000339157 ENSP00000339157 ENSP00000447255 ENSP00000448517 ENSP00000339157 gi|38327526|ref|NP_938079.1| gi|53832021|ref|NP_001005502.1| gi|6631081|ref|NP_001865.1| ENSP00000339157 ENSP00000447255 ENSP00000448517 MPIB-427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]