SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000340149 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340149
Domain Number 1 Region: 34-177
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0000000000000746
Family Integrin alpha N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340149   Gene: ENSG00000115232   Transcript: ENST00000339307
Sequence length 195
Comment pep:putative chromosome:GRCh38:2:181457207:181476218:1 gene:ENSG00000115232 transcript:ENST00000339307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHS
HGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRI
APCYQGSISKYRART
Download sequence
Identical sequences ENSP00000340149 ENSP00000340149 NP_001303241.1.87134 NP_001303241.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]