SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000341264 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341264
Domain Number 1 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000969
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 2 Region: 158-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000062
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 118-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000272
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341264   Gene: ENSG00000123384   Transcript: ENST00000338962
Sequence length 292
Comment pep:putative chromosome:GRCh38:12:57128716:57150059:1 gene:ENSG00000123384 transcript:ENST00000338962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Download sequence
Identical sequences ENSP00000341264 ENSP00000341264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]