SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000341883 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341883
Domain Number 1 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 164-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 332-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 62-106
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000017
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341883   Gene: ENSG00000189298   Transcript: ENST00000341464
Sequence length 390
Comment pep:known chromosome:GRCh38:6:28349950:28366746:1 gene:ENSG00000189298 transcript:ENST00000341464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPVLAHGGCCREDKVVASRLTP
ESQGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEE
LPEKEHGKISCHLREDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSG
LSKHRRIHTGEKPYECEECGKAFIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKH
QRTHTGEKPYECDDCGKTFSQSCSLLEHHRIHTGEKPYQCSMCGKAFRRSSHLLRHQRIH
TGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFTQNTGLIEHQKIHTGEKPY
QCNACGKGFTRISYLVQHQRSHVGKNILSQ
Download sequence
Identical sequences NP_001229824.1.87134 NP_001229824.1.92137 XP_006715281.1.92137 ENSP00000341883 ENSP00000341883 gi|339276021|ref|NP_001229824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]