SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000343190 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343190
Domain Number 1 Region: 15-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.22e-58
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.000000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343190   Gene: ENSG00000138621   Transcript: ENST00000342932
Sequence length 204
Comment pep:known chromosome:GRCh38:15:75023555:75050726:1 gene:ENSG00000138621 transcript:ENST00000342932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFY
SPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLL
TCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGA
MAEVGTIVDKVKEVLFQHSGFQQS
Download sequence
Identical sequences Q96CD2
ENSP00000343190 ENSP00000343190 9606.ENSP00000343190 ENSP00000343190 gi|71725351|ref|NP_068595.3| NP_068595.3.87134 NP_068595.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]