SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000343376 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343376
Domain Number 1 Region: 99-128,244-379,475-541
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000109
Family FAD/NAD-linked reductases, N-terminal and central domains 0.063
Further Details:      
 
Weak hits

Sequence:  ENSP00000343376
Domain Number - Region: 370-494
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0787
Family Alcohol dehydrogenase-like, C-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343376   Gene: ENSG00000140961   Transcript: ENST00000343939
Sequence length 560
Comment pep:putative chromosome:GRCh38:16:83949067:83966332:1 gene:ENSG00000140961 transcript:ENST00000343939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKWRPRGCCRGNMQCRQEVPATLTSSELFSTRNQPQPQPQPLLADAPVPWAVASRMCLT
PGQGCGHQGQDEGPLPAPSPPPAMSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSG
YTPYTKPDAIHPHPLLQRKLTEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDT
DFGGNMKSVLTWKHRKEHAIPHVVLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDW
MQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSS
PLFQVSGFLTRNQAQQPFSLWARNVVLATGTFDSPARLGIPGEALPFIHHELSALEAATR
VGAVTPASDPVLIIGAGLSAADAVLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEY
HKVHQMMREQSILSPSPYEGYRSLPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIG
SHPDLSFLPGAGADFAVDPDQPLSAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFV
QGGALAVASSLLRKETRKPP
Download sequence
Identical sequences Q9UJX0
ENSP00000343376 gi|118572590|ref|NP_037502.3| ENSP00000343376 9606.ENSP00000343376 ENSP00000343376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]