SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344779 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344779
Domain Number 1 Region: 25-208
Classification Level Classification E-value
Superfamily Rhomboid-like 4.97e-33
Family Rhomboid-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344779   Gene: ENSG00000144468   Transcript: ENST00000341329
Sequence length 315
Comment pep:known chromosome:GRCh38:2:226835936:226999215:1 gene:ENSG00000144468 transcript:ENST00000341329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCY
QQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYL
LLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVEL
VAIHLFSPGTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSS
GYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLS
PEEMRRQRLHRFDSQ
Download sequence
Identical sequences A0A024R455 Q8TEB9
9606.ENSP00000344779 ENSP00000375914 ENSP00000344779 ENSP00000375914 ENSP00000344779 ENSP00000375914 NP_001161080.1.87134 NP_001161080.1.92137 NP_115652.2.87134 NP_115652.2.92137 XP_016860572.1.92137 XP_016860573.1.92137 XP_016860574.1.92137 XP_016860575.1.92137 XP_016860576.1.92137 XP_016860577.1.92137 XP_016860578.1.92137 XP_016860579.1.92137 XP_016860580.1.92137 XP_016860581.1.92137 gi|263190666|ref|NP_001161080.1| gi|33300639|ref|NP_115652.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]