SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345771 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345771
Domain Number 1 Region: 411-824
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.72e-110
Family Phosphofructokinase 0.00000718
Further Details:      
 
Domain Number 2 Region: 86-409
Classification Level Classification E-value
Superfamily Phosphofructokinase 8.37e-106
Family Phosphofructokinase 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345771   Gene: ENSG00000152556   Transcript: ENST00000340802
Sequence length 851
Comment pep:putative chromosome:GRCh38:12:48105923:48146104:1 gene:ENSG00000152556 transcript:ENST00000340802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKDEFHLKFFMCVIQSRQLVRTPQRTAGEASTSSMLIPKPPPKTDILKSLDTMDDPDTV
GSIPVFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATV
SNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEH
ITRKRSGEAAV
Download sequence
Identical sequences K7AUT0
ENSP00000309438 gi|266453619|ref|NP_001160158.1| 9598.ENSPTRP00000008335 NP_001160158.1.87134 NP_001160158.1.92137 XP_003825835.1.60992 XP_005269034.1.92137 XP_005269035.1.92137 XP_005269036.1.92137 XP_008949375.1.60992 XP_008949376.1.60992 XP_016779016.1.37143 XP_016779017.1.37143 XP_016779018.1.37143 XP_016779019.1.37143 XP_016874957.1.92137 ENSP00000345771 ENSP00000345771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]