SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000346342 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000346342
Domain Number 1 Region: 117-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-58
Family SPRY domain 0.000000953
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000156
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000346342   Gene: ENSG00000128250   Transcript: ENST00000354373
Sequence length 317
Comment pep:known chromosome:GRCh38:22:29438583:29442455:1 gene:ENSG00000128250 transcript:ENST00000354373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVC
FKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRM
RKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRH
YWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDR
KLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICP
VINPGTTDAPVHPGEAK
Download sequence
Identical sequences O75677
ENSP00000346342 ENSP00000346342 ENSP00000346342 NP_066306.2.87134 NP_066306.2.92137 9606.ENSP00000346342 gi|149408130|ref|NP_066306.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]