SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000348696 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348696
Domain Number 1 Region: 261-522
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-87
Family Protein kinases, catalytic subunit 0.000000000204
Further Details:      
 
Weak hits

Sequence:  ENSP00000348696
Domain Number - Region: 79-182
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0445
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348696   Gene: ENSG00000149269   Transcript: ENST00000356341
Sequence length 545
Comment pep:known chromosome:GRCh38:11:77321707:77474062:-1 gene:ENSG00000149269 transcript:ENST00000356341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
Download sequence
Identical sequences A0A024R5P0 A0A2I3H6Y7 A0A2J8V0U5 G3RY99 K7DSU6 Q13153
ENSNLEP00000020301 ENSP00000348696 ENSP00000348696 gi|42794769|ref|NP_002567.3| NP_002567.3.87134 NP_002567.3.92137 XP_003254723.1.23891 XP_008958490.1.60992 XP_008958491.1.60992 XP_008958492.1.60992 XP_008958493.1.60992 XP_008958494.1.60992 XP_008958495.1.60992 XP_008958496.1.60992 XP_014202423.1.60992 XP_014202424.1.60992 XP_016777167.1.37143 XP_016777168.1.37143 XP_016777170.1.37143 XP_016777171.1.37143 XP_016777172.1.37143 XP_016777173.1.37143 XP_016777174.1.37143 XP_016777175.1.37143 XP_016873335.1.92137 XP_016873336.1.92137 XP_016873337.1.92137 XP_016873338.1.92137 XP_016873339.1.92137 XP_018892875.1.27298 XP_018892876.1.27298 XP_018892877.1.27298 XP_018892878.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]