SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000349270 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349270
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Globin-like 1.57e-42
Family Globins 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349270   Gene: ENSG00000206177   Transcript: ENST00000356815
Sequence length 141
Comment pep:known chromosome:GRCh38:16:165978:166768:1 gene:ENSG00000206177 transcript:ENST00000356815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQ
RMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQ
MQAAWDKFLTGVAVVLTEKYR
Download sequence
Identical sequences A0A1K0FU50 Q6B0K9
ENSP00000349270 9606.ENSP00000349270 ENSP00000349270 gi|51510893|ref|NP_001003938.1| ENSP00000349270 NP_001003938.1.87134 NP_001003938.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]