SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000349774 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349774
Domain Number 1 Region: 426-531
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSP00000349774
Domain Number - Region: 66-111,140-187
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0502
Family Cytochrome c3-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349774   Gene: ENSG00000089091   Transcript: ENST00000357236
Sequence length 559
Comment pep:putative chromosome:GRCh38:20:18383371:18454639:-1 gene:ENSG00000089091 transcript:ENST00000357236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSL
VPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQES
MCSGDKAPPPPTQKGGTISCYRCGRWNLWEASFCGWCGAMLGIPAGCSVCPKCGASNHLS
ARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSEPRCAWQSLNIPLPRSDVGTKRDIGT
QTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAHLRC
YAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLS
SAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKTKTFQEKKEQLIPENRLLLKEV
GPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGP
LRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKF
GQGLEDQLAQTRSLSLDDC
Download sequence
Identical sequences A0A0A0MRE2
ENSP00000349774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]