SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350386 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350386
Domain Number 1 Region: 4-448,560-615
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.63e-82
Family GDI-like N domain 0.000000000000995
Further Details:      
 
Domain Number 2 Region: 448-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.1e-41
Family GDI-like 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350386   Gene: ENSG00000188419   Transcript: ENST00000357749
Sequence length 653
Comment pep:known chromosome:GRCh38:X:85861180:86047562:-1 gene:ENSG00000188419 transcript:ENST00000357749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHALVTSANSTEAADSAFLPTEDESLSTMSCEMLTEQTPSSDPENALEVNGAEVTGEKEN
HCDDKTCVPSTSAEDMSENVPIAEDTTEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLTMVEKRMLMKFLT
FCMEYEKYPDEYKGYEEITFYEYLKTQKLTPNLQYIVMHSIAMTSETASSTIDGLKATKN
FLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAII
DQFGQRIISEHFLVEDSYFPENMCSRVQYRQISRAVLITDRSVLKTDSDQQISILTVPAE
EPGTFAVRVIELCSSTMTCMKGTYLVHLTCTSSKTAREDLESVVQKLFVPYTEMEIENEQ
VEKPRILWALYFNMRDSSDISRSCYNDLPSNVYVCSGPDCGLGNDNAVKQAETLFQEICP
NEDFCPPPPNPEDIILDGDSLQPEASESSAIPEANSETFKESTNLGNLEESSE
Download sequence
Identical sequences P24386
ENSP00000350386 NP_000381.1.87134 NP_000381.1.92137 gi|9966761|ref|NP_000381.1| ENSP00000350386 ENSP00000350386 9606.ENSP00000350386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]