SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351046 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351046
Domain Number 1 Region: 49-173
Classification Level Classification E-value
Superfamily SET domain 9.81e-40
Family Histone lysine methyltransferases 0.00079
Further Details:      
 
Weak hits

Sequence:  ENSP00000351046
Domain Number - Region: 5-53
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0353
Family Tryptophan biosynthesis enzymes 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351046   Gene: ENSG00000152455   Transcript: ENST00000358298
Sequence length 176
Comment pep:novel chromosome:GRCh38:10:14881500:14903593:1 gene:ENSG00000152455 transcript:ENST00000358298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKVITSEEAERRG
QFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRI
ALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Download sequence
Identical sequences H0Y306
ENSP00000351046 ENSP00000351046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]