SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351232 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351232
Domain Number 1 Region: 355-664
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.69e-115
Family PDEase 0.0000000769
Further Details:      
 
Domain Number 2 Region: 132-334
Classification Level Classification E-value
Superfamily GAF domain-like 9.81e-43
Family GAF domain 0.00016
Further Details:      
 
Domain Number 3 Region: 53-148
Classification Level Classification E-value
Superfamily GAF domain-like 2.21e-25
Family GAF domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351232   Gene: ENSG00000128655   Transcript: ENST00000358450
Sequence length 683
Comment pep:known chromosome:GRCh38:2:177628069:178108339:-1 gene:ENSG00000128655 transcript:ENST00000358450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQARRPLFRNVLSATQWKKVKITRLVQISGASLAEKQEKHQDFLIQRQTKTKDRRFND
EIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQMYLPFCGIAI
SNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLED
IESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTGLPVNISD
AYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAF
VIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELAIDD
IHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAF
NVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGSALAQLYGTS
ATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTEFFEL
VSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQGDRERLELK
LTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVATNRSKWEELHQ
KRLLASTASSSPASVMVAKEDRN
Download sequence
Identical sequences gi|116536087|ref|NP_001070665.1| NP_001070665.1.87134 NP_001070665.1.92137 ENSP00000351232 ENSP00000351232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]