SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351273 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351273
Domain Number 1 Region: 283-537
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-89
Family Caspase catalytic domain 0.000000000261
Further Details:      
 
Domain Number 2 Region: 60-172
Classification Level Classification E-value
Superfamily DEATH domain 1.71e-33
Family DEATH effector domain, DED 0.0038
Further Details:      
 
Domain Number 3 Region: 157-238
Classification Level Classification E-value
Superfamily DEATH domain 3.06e-19
Family DEATH effector domain, DED 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351273   Gene: ENSG00000064012   Transcript: ENST00000358485
Sequence length 538
Comment pep:known chromosome:GRCh38:2:201258036:201287711:1 gene:ENSG00000064012 transcript:ENST00000358485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADYILLPFKKM
DFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSF
LKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFK
FLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEF
SKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINN
HNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQL
MDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQ
GDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWY
IQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Download sequence
Identical sequences ENSP00000351273 NP_001073594.1.87134 NP_001073594.1.92137 9606.ENSP00000351273 gi|122056476|ref|NP_001073594.1| ENSP00000376094 ENSP00000351273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]