SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351947 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351947
Domain Number 1 Region: 724-1005
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.56e-58
Family Tandem AAA-ATPase domain 0.0000844
Further Details:      
 
Domain Number 2 Region: 496-722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-55
Family Tandem AAA-ATPase domain 0.0000759
Further Details:      
 
Weak hits

Sequence:  ENSP00000351947
Domain Number - Region: 246-295
Classification Level Classification E-value
Superfamily UBA-like 0.000357
Family CUE domain 0.026
Further Details:      
 
Domain Number - Region: 394-431
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00623
Family ComEA-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351947   Gene: ENSG00000163104   Transcript: ENST00000359052
Sequence length 1028
Comment pep:known chromosome:GRCh38:4:94207611:94291290:1 gene:ENSG00000163104 transcript:ENST00000359052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLFNLDRFRFEKRNKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSRANTPDSDIT
EKTEDSSVPETPDNERKASISYFKNQRGIQYIDLSSDSEDVVSPNCSNTVQEKTFNKDTV
IIVSEPSEDEESQGLPTMARRNDDISELEDLSELEDLKDAKLQTLKELFPQRSDNDLLKL
IESTSTMDGAIAAALLMFGDAGGGPRKRKLSSSSEPYEEDEFNDDQSIKKTRLDHGEESN
ESAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQY
VSQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKKRKKNVFNPKRVVEDSEY
DSGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQDASIGELTLIPQCSQKKAQKITELRP
FNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLTGNG
GGWNIEQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLY
QEGNNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVI
VTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPV
QNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFIL
RRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLVTEKNTEMCNVMMQL
RKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYR
HINNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYL
RLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQ
AEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEGDEGSMPADIAT
LLKTSMGL
Download sequence
Identical sequences ENSP00000351947 ENSP00000415576 gi|190358532|ref|NP_001121901.1| gi|190358536|ref|NP_001121902.1| ENSP00000346217 NP_001121901.1.87134 NP_001121901.1.92137 NP_001121902.1.87134 NP_001121902.1.92137 ENSP00000351947 ENSP00000415576 9606.ENSP00000351947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]