SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352026 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000352026
Domain Number - Region: 25-92
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0199
Family Di-heme elbow motif 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352026   Gene: ENSG00000258289   Transcript: ENST00000359118
Sequence length 108
Comment pep:known chromosome:GRCh38:14:64914444:64932636:1 gene:ENSG00000258289 transcript:ENST00000359118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDPD
LCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCAKPKILSVFSLMTPDK
Download sequence
Identical sequences ENSP00000352026 HR522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]