SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352265 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000352265
Domain Number 1 Region: 36-74
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000131
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352265   Gene: ENSG00000141933   Transcript: ENST00000359315
Sequence length 290
Comment pep:known chromosome:GRCh38:19:507299:519654:1 gene:ENSG00000141933 transcript:ENST00000359315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVEKRRQAVPPPAGFTDSGRQSVSRAAGAAESEEDFLRQVGVTEMLRAALLKVLEARP
EEPIAFLAHYFENMGLRSPVNGGAGEPPGQLLLQQQRLGRALWHLRLAHHSQRAAFNNNV
SVAYECLSAGGRRKRPGLDGRTYSELLRRICRDGQAPEEVVAPLLRKVQCRDHEAVPLSV
FRAGTLTCFVLLEFVARAGALFQLLEDSAAAVADRRVGQAVLDTLEGALQASDAAAPARF
LEAGSRLGPDSLALALDRAVGGRRPSAPMTREEFLERAAALFIAKVKPVG
Download sequence
Identical sequences Q6ZTW0
ENSP00000352265 NP_277048.2.87134 NP_277048.2.92137 ENSP00000352265 ENSP00000352265 9606.ENSP00000352265 gi|123173766|ref|NP_277048.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]