SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352789 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000352789
Domain Number 1 Region: 27-157
Classification Level Classification E-value
Superfamily Cupredoxins 2.31e-43
Family Ephrin ectodomain 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352789   Gene: ENSG00000243364   Transcript: ENST00000359751
Sequence length 193
Comment pep:known chromosome:GRCh38:1:155063737:155069538:1 gene:ENSG00000243364 transcript:ENST00000359751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLP
ALGVPIQTDKMEH
Download sequence
Identical sequences A0A2J8Q2Z8
NP_872632.2.87134 NP_872632.2.92137 XP_001152971.1.37143 XP_003817145.1.60992 ENSP00000352789 gi|100913200|ref|NP_872632.2| ENSP00000352789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]