SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352924 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000352924
Domain Number 1 Region: 37-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000685
Family I set domains 0.079
Further Details:      
 
Weak hits

Sequence:  ENSP00000352924
Domain Number - Region: 146-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00191
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352924   Gene: ENSG00000149582   Transcript: ENST00000359862
Sequence length 322
Comment pep:known chromosome:GRCh38:11:118531088:118535832:1 gene:ENSG00000149582 transcript:ENST00000359862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGT
PRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANA
SVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFL
VLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNL
KLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGF
IRLPVLGYIYRVSSVSSDEIWL
Download sequence
Identical sequences gi|221139830|ref|NP_001137506.1| gi|221219039|ref|NP_001137507.1| ENSP00000352924 ENSP00000411882 ENSP00000431205 ENSP00000469062 ENSP00000469390 ENSP00000471941 ENSP00000352924 ENSP00000411882 ENSP00000431205 NP_001137506.1.87134 NP_001137506.1.92137 NP_001137507.1.87134 NP_001137507.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]