SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354171 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354171
Domain Number 1 Region: 144-202
Classification Level Classification E-value
Superfamily ARM repeat 0.0000975
Family HEAT repeat 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354171   Gene: ENSG00000163138   Transcript: ENST00000360916
Sequence length 221
Comment pep:known chromosome:GRCh38:4:20700413:20728357:1 gene:ENSG00000163138 transcript:ENST00000360916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSEGSGGTQLKNRATGNYDQRTSSSTQLKHRNAVQGSKSSLSTSSPESARKLHPRPSD
KLNPKTINPFGEQSRVPSAFAAIYSKGGIPCRLVHGSVKHRLQWECPPESLSFDPLLITL
AEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLN
ALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIPTYCSICC
Download sequence
Identical sequences NP_659485.1.87134 NP_659485.1.92137 XP_011512107.1.92137 XP_016863240.1.92137 XP_016863241.1.92137 XP_016863242.1.92137 ENSP00000295290 ENSP00000354171 ENSP00000423477 ENSP00000423536 ENSP00000425938 gi|21450808|ref|NP_659485.1| 9606.ENSP00000295290 GO.36898 ENSP00000295290 ENSP00000354171 ENSP00000423477 ENSP00000423536 ENSP00000425938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]