SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354721 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354721
Domain Number 1 Region: 534-561,604-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.14e-16
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354721   Gene: ENSG00000145217   Transcript: ENST00000361661
Sequence length 701
Comment pep:known chromosome:GRCh38:4:987657:993436:-1 gene:ENSG00000145217 transcript:ENST00000361661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLQPGANSSTLNGSAAMLDCGRDCYAIRV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRGAGQANVCDVVTSTVCLAVLLAAKELSDRYRHRLRVPLPTELLVIV
VATLVSHFGQLHKRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALALVAAAFSISLA
EMFARSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLAGVILSLLSLAGRTQRPRTALLARIGDTAFYEDATEFEGLVPEPGVRVF
RFGGPLYYANKDFFLQSLYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRA
ALVPAAAGFHTVVIDCAPLLFLDAAGVSTLQDLRRDYGALGISLLLACCSPPVRDILSRG
GFLGEGPGDTAEEEQLFLSVHDAVQTARARHRELEATDAHL
Download sequence
Identical sequences Q9H2B4
9606.ENSP00000354721 gi|20336272|ref|NP_071325.2| gi|47131207|ref|NP_998778.1| ENSP00000354721 ENSP00000381528 NP_071325.2.87134 NP_071325.2.92137 NP_998778.1.87134 NP_998778.1.92137 ENSP00000354721 ENSP00000381528 ENSP00000381528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]