SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355847 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355847
Domain Number 1 Region: 461-764
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.59e-102
Family PDEase 0.000000602
Further Details:      
 
Domain Number 2 Region: 247-438
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 90-239
Classification Level Classification E-value
Superfamily GAF domain-like 1.5e-19
Family GAF domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355847   Gene: ENSG00000112541   Transcript: ENST00000366882
Sequence length 779
Comment pep:putative chromosome:GRCh38:6:165327287:165662100:-1 gene:ENSG00000112541 transcript:ENST00000366882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
Download sequence
Identical sequences A0A1B1UZR0 G3QMU8 Q9Y233
NP_006652.1.87134 NP_006652.1.92137 XP_011533690.1.92137 gi|5729972|ref|NP_006652.1| ENSP00000355847 ENSP00000346435 ENSP00000355847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]