SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356918 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356918
Domain Number 1 Region: 12-220
Classification Level Classification E-value
Superfamily t-snare proteins 2.51e-48
Family t-snare proteins 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356918   Gene: ENSG00000079950   Transcript: ENST00000367941
Sequence length 261
Comment pep:known chromosome:GRCh38:6:132445867:132513062:-1 gene:ENSG00000079950 transcript:ENST00000367941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTN
QLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVA
RVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA
DIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCI
IILILVIGVAIISLIIWGLNH
Download sequence
Identical sequences G3QNE2 O15400
ENSP00000356918 9606.ENSP00000356918 ENSP00000356914 ENSP00000356918 gi|170932494|ref|NP_003560.2| NP_003560.2.87134 NP_003560.2.92137 XP_003827710.1.60992 XP_004044736.1.27298 ENSGGOP00000004057 ENSGGOP00000004057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]