SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 76_38 > ENSP00000356949

Domain assignment for ENSP00000356949 from Homo sapiens 76_38

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000356949
Domain Number 1	Region: 119-204
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	6.36e-16
Family	I set domains	0.0000136
Further Details:

Domain Number 2	Region: 37-118
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.00000000000000613
Family	I set domains	0.0000192
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000356949 Gene: ENSG00000143226 Transcript: ENST00000367972
Sequence length	316
Comment	pep:known chromosome:GRCh38:1:161505430:161518558:1 gene:ENSG00000143226 transcript:ENST00000367972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLT CQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLS EWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSH SGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYC RKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDK NIYLTLPPNDHVNSNN
Download sequence
Identical sequences	ENSP00000356949 ENSP00000356949 NP_067674.2.87134 NP_067674.2.92137 gi\|50511936\|ref\|NP_067674.2\|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]