SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357391 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357391
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily Cupredoxins 9.73e-48
Family Ephrin ectodomain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357391   Gene: ENSG00000169242   Transcript: ENST00000368406
Sequence length 183
Comment pep:known chromosome:GRCh38:1:155127876:155134857:1 gene:ENSG00000169242 transcript:ENST00000368406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
DAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLL
QTP
Download sequence
Identical sequences A0A2I2YAH3 A0A2I3RAD8
NP_872626.1.87134 NP_872626.1.92137 XP_003308473.1.37143 gi|33359680|ref|NP_872626.1| ENSP00000357391 ENSP00000357391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]