SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357392 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357392
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily Cupredoxins 1.82e-49
Family Ephrin ectodomain 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357392   Gene: ENSG00000169242   Transcript: ENST00000368407
Sequence length 205
Comment pep:known chromosome:GRCh38:1:155127460:155134857:1 gene:ENSG00000169242 transcript:ENST00000368407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
DAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG
HSAAPRLFPLAWTVLLLPLLLLQTP
Download sequence
Identical sequences G3R1K1 H2Q067 P20827
gi|33359682|ref|NP_004419.2| 9606.ENSP00000357392 ENSPTRP00000002368 ENSP00000357392 ENSPTRP00000002368 NP_004419.2.87134 NP_004419.2.92137 XP_001141980.2.37143 XP_003817120.1.60992 XP_018879061.1.27298 ENSP00000357391 ENSP00000357392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]