SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357393 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357393
Domain Number 1 Region: 31-170
Classification Level Classification E-value
Superfamily Cupredoxins 1.22e-47
Family Ephrin ectodomain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357393   Gene: ENSG00000143590   Transcript: ENST00000368408
Sequence length 238
Comment pep:known chromosome:GRCh38:1:155078872:155087538:1 gene:ENSG00000143590 transcript:ENST00000368408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Download sequence
Identical sequences A0A096MU07 A0A2I3FTA7 A0A2K5LJU1 A0A2K5VZR7 A0A2K5XJT5 A0A2K6BDW9 A0A2K6JYG9 A0A2K6P8G2 H2N5I3 H2Q066 I2CYI5 P52797
ENSPTRP00000002366 ENSPTRP00000002366 ENSMMUP00000024918 9544.ENSMMUP00000024918 9600.ENSPPYP00000000881 9606.ENSP00000357393 ENSPPYP00000000881 ENSPPYP00000000881 ENSP00000391370 ENSP00000357393 NP_001252612.1.72884 NP_004943.1.87134 NP_004943.1.92137 XP_002810124.1.23681 XP_003308464.1.37143 XP_003817140.1.60992 XP_005541668.1.63531 XP_010362954.1.97406 XP_011767989.1.29376 XP_011842851.1.47321 XP_011932153.1.92194 XP_017723266.1.44346 ENSMMUP00000024918 ENSNLEP00000014368 gi|4826708|ref|NP_004943.1| ENSP00000357393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]